PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g06317.1.p
Common NameBRADI_4g06317, LOC100824318
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 389aa    MW: 42070 Da    PI: 6.5687
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g06317.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.12.6e-153279148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g W++eEde+lv +  + G g+W+ +ar  g+ R++k+c++rw +yl
  Bradi4g06317.1.p 32 KGLWSPEEDERLVAYMLRSGQGSWSDVARNAGLLRCGKSCRLRWINYL 79
                      678*****************************99************97 PP

2Myb_DNA-binding51.62.1e-1685128146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+++++E++l+v++++ lG++ W+ Ia++++ gRt++++k++w++
  Bradi4g06317.1.p  85 RGAFSPQEEDLIVNLHAILGNR-WSQIAARLP-GRTDNEIKNFWNS 128
                       89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.5452779IPR017930Myb domain
SuperFamilySSF466894.3E-2830126IPR009057Homeodomain-like
SMARTSM007176.1E-113181IPR001005SANT/Myb domain
PfamPF002493.1E-133279IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-213386IPR009057Homeodomain-like
CDDcd001678.48E-93579No hitNo description
PROSITE profilePS5129424.97180134IPR017930Myb domain
SMARTSM007171.3E-1584132IPR001005SANT/Myb domain
PfamPF002496.9E-1585128IPR001005SANT/Myb domain
CDDcd001673.29E-1187127No hitNo description
Gene3DG3DSA:1.10.10.602.2E-2587134IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MRKPECPTTK AASGPGNSCS NVVAASAAKL RKGLWSPEED ERLVAYMLRS GQGSWSDVAR  60
NAGLLRCGKS CRLRWINYLR PDLKRGAFSP QEEDLIVNLH AILGNRWSQI AARLPGRTDN  120
EIKNFWNSTI KKRLKVSSAA SSPATTTECA SPPEPKLDVG CLDLASLEDG GHHAMIKSTW  180
RMMDSSSSTS SSSSMQTRPS SAMAAASRSY SGGLLLPLPD QVCGGGETQA PPLFFHDHHP  240
LSFKHASALH GGSYYHHGVA MEDGGAGCFM GEEVVAGEES ALFNVPPPLQ LEPAMAAAQD  300
QTLMASRNKS TTPEATTLSS NNGSNITDNN DNSKNNNVSS SVVYWPEQLH GHQQQQQQHM  360
SRNVMGEWDL EELMKDVSSL PFLDFQVE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-272913424128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6720681e-143AY672068.1 Hordeum vulgare subsp. vulgare myb transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575963.10.0PREDICTED: myb-related protein Zm38
TrEMBLI1II190.0I1II19_BRADI; Uncharacterized protein
STRINGBRADI4G06317.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP98213545
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.11e-65myb domain protein 83